PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00077181001
Common NameGSBRNA2T00077181001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 266aa    MW: 29062 Da    PI: 8.8691
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00077181001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.81.3e-2427691355
              G2-like 13 rFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+R 
  GSBRNA2T00077181001 27 RFVNAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRQ 69
                         8*****************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.5E-92769IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-212769IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-162769IPR006447Myb domain, plants
PfamPF143796.2E-24114163IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MYSAAIRSLL PLDGSMGEYS DGTNLPRFVN AVTQLGGPDK ATPKTIMRTM GVKGLTLYHL  60
KSHLQKFRQG RQLCKESTEN SKDVSCAAES QDTGSSSTSS LRLAAQEQNE YSYQVTEALR  120
AQMEVQRRLH EQLEYGQVQR RLQLRIEAQG KYLQSVLEKA CKAIEDQAVA FAGLEAAREE  180
LSELAIKVSN GSQVPFHTTK MTVPSLSELA VAIEHKKNCS AESSLTSSPV SAALMKKRHR  240
GVFRNGESLV VGHETGWVMP SSTLG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.89900.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00077181001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532350.0AK353235.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-27-H18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602254.11e-179PREDICTED: myb family transcription factor APL isoform X1
RefseqXP_013708594.11e-179PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK51e-45APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078I0T20.0A0A078I0T2_BRANA; BnaA08g05130D protein
STRINGAT4G13640.21e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.21e-146G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]